top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr15|101382091|101398576|-|5|circRNA|PCSK6|ENST00000611716.4|11,10,9,8,7 | circPCSK6(11,10,9,8,7) | PCSK6 | LVDAEALVVEAKKWTAVPSQHMCVAASDKRPRHPHAGRRCHRCGRGKVAGHQTQLHRHLQCQLGAGRRRQDGGRARPTG | VAGHQTQLHR | No | Alternative | Junction | 10 | 3 | TTG | TAA | NA | No |
chr15|101661711|101686062|-|6|circRNA|TARSL2|ENST00000335968.7|16,15,14,13,12,11 | circTARSL2(16,15,14,13,12,11) | TARSL2 | LGSVERMIAILSENYGGKWRNITNGTSRRCSLPICTTVNSGKPQATGSITARTCLPLRLKRTLLPSNP | WRNITNGTSR | No | Junction | Junction | 10 | 2 | TTG | TGA | TransCirc | No |
chr15|20669467|20671268|-|2|circRNA|NBEAP1|ENST00000554452.5|4,3 | circNBEAP1(4,3) | NBEAP1 | LSAEFIGTATIYTTICRIGTVIKDNAHLKILLLGY | IGTVIKDNAHLK | No | Alternative | Alternative | 12 | 1 | TTG | TAA | NA | No |
chr15|23000568|23006352|-|6|circRNA|TUBGCP5|ENST00000614508.4|22,21,20,19,18,17 | circTUBGCP5(22,21,20,19,18,17) | TUBGCP5 | MESIEKMESDFKNCHMFLVTILNKAVCRGSFPHFYLYLLKMLTQLRRSCLFIS | GSFPHFYLYLLK | No | Junction | Junction | 12 | 2 | ATG | TAG | TransCirc | No |
chr15|23000568|23006352|-|6|circRNA|TUBGCP5|ENST00000614508.4|22,21,20,19,18,17 | circTUBGCP5(22,21,20,19,18,17) | TUBGCP5 | MESIEKMESDFKNCHMFLVTILNKAVCRGSFPHFYLYLLKMLTQLRRSCLFIS | MLTQLRR | No | Alternative | Junction | 7 | 2 | ATG | TAG | TransCirc | No |
Page 1 of 1
bottom of page