top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr14|91881291|91895072|-|5|circRNA|FBLN5|NM_006329|9,8,7,6,5 | circFBLN5(9,8,7,6,5) | FBLN5 | MWTSVQQIPTSATPPRSASILKAGTPAPAPTDIGFWKASA | SASILKAGTPAPAPTDIGFWK | No | Alternative | Alternative | 21 | 2 | ATG | TAG | riboCIRC,TransCirc | No |
chr14|91993808|92006448|-|5|circRNA|TRIP11|ENST00000267622.8|15,14,13,12,11 | circTRIP11(15,14,13,12,11) | TRIP11 | LLLPRKQLLSNCKMKIKNCPLDLKVVAKICLEKLFRIYHVSFEKKTSK | IKNCPLDLK | No | Alternative | Alternative | 9 | 1 | TTG | TAG | TransCirc | No |
chr14|91993808|92006448|-|5|circRNA|TRIP11|ENST00000267622.8|15,14,13,12,11 | circTRIP11(15,14,13,12,11) | TRIP11 | LLLPRKQLLSNCKMKIKNCPLDLKVVAKICLEKLFRIYHVSFEKKTSK | IYHVSFEK | No | Alternative | Alternative | 8 | 1 | TTG | TAG | TransCirc | No |
chr14|92134010|92138347|+|4|circRNA|CPSF2|ENST00000298875.8|4,5,6,7 | circCPSF2(4,5,6,7) | CPSF2 | LEMLSRPSLLITDSFNATYVQPRRKQRDEQLLSMFTRLMQCCCLTLILSTLVPSRMLSESWV | LMQCCCLTLILSTLVPSR | No | Alternative | Junction | 18 | 2 | CTG | TGA | TransCirc | No |
chr14|92134010|92138347|+|4|circRNA|CPSF2|ENST00000298875.8|4,5,6,7 | circCPSF2(4,5,6,7) | CPSF2 | LEMLSRPSLLITDSFNATYVQPRRKQRDEQLLSMFTRLMQCCCLTLILSTLVPSRMLSESWV | LMQCCCLTLILSTLVPSRMLSESWV | No | Alternative | Junction | 25 | 2 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page