top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr14|88574692|88609803|+|9|circRNA|ZC3H14|NM_001160103|7,8,9,10,11,12,13,14,15 | circZC3H14(7,8,9,10,11,12,13,14,15) | ZC3H14 | LHHQHHLPVVSSAVTSLLVRRWNVPSIIQKMKTFGRESCLW | LHHQHHLPVVSSAVTSLLVR | No | Alternative | Junction | 20 | 1 | TTG | TAA | TransCirc | No |
chr14|88657375|88688359|-|10|circRNA|EML5|ENST00000553281.5|20,19,18,17,16,15,14,13,12,11 | circEML5(20,19,18,17,16,15,14,13,12,11) | EML5 | MLGIKPHLQQKEPSIDERRCVYLERHLSCKNSESA | EPSIDERR | No | Junction | Junction | 8 | 3 | ATG | TGA | TransCirc | No |
chr14|88657375|88688359|-|10|circRNA|EML5|ENST00000553281.5|20,19,18,17,16,15,14,13,12,11 | circEML5(20,19,18,17,16,15,14,13,12,11) | EML5 | MLGIKPHLQQKEPSIDERRCVYLERHLSCKNSESA | HLSCKNSESA | No | Alternative | Junction | 10 | 3 | ATG | TGA | TransCirc | No |
chr14|90676522|90689712|-|3|circRNA|TTC7B|ENST00000328459.10|9,8,7 | circTTC7B(9,8,7) | TTC7B | LNTRVTASSVCRVHLWSMTYSPLLLEEEASMRCCQRQ | VHLWSMTYSPLLLEEEASMRCCQR | No | Alternative | Junction | 24 | 2 | CTG | TAG | TransCirc | No |
chr14|90676522|90689712|-|3|circRNA|TTC7B|ENST00000328459.10|9,8,7 | circTTC7B(9,8,7) | TTC7B | LNTRVTASSVCRVHLWSMTYSPLLLEEEASMRCCQRQ | VTASSVCR | No | Alternative | Junction | 8 | 2 | CTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page