top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr14|64055943|64102042|+|16|circRNA|SYNE2|NM_015180|49,50,51,52,53,54,55,56,57,58,59,60,61,62,63,64 | circSYNE2(49,50,51,52,53,54,55,56,57,58,59,60,61,62,63,64) | SYNE2 | MEMRRQSHRLSLGLHFGSMTRTWKKTELPHPLEQLFRMS | LSLGLHFGSMTRTWK | No | Alternative | Junction | 15 | 2 | ATG | TGA | TransCirc | No |
chr14|64139940|64152716|+|6|circRNA|SYNE2|NM_015180|80,81,82,83,84,85 | circSYNE2(80,81,82,83,84,85) | SYNE2 | LKQSYLTLESGAVPLLEDTASRIDELFQKRSSVLTQL | SSVLTQL | No | Alternative | Junction | 7 | 1 | TTG | TAA | TransCirc | No |
chr14|64208757|64214470|+|6|circRNA|SYNE2|NM_015180|101,102,103,104,105,106 | circSYNE2(101102103104105000) | SYNE2 | MKRRPLRMKQTWKTPEKSRLILGVNGERARNRHLLSPCVI | LILGVNGER | No | Alternative | Alternative | 9 | 2 | ATG | TAG | TransCirc | No |
chr14|64208757|64214470|+|6|circRNA|SYNE2|NM_015180|101,102,103,104,105,106 | circSYNE2(101102103104105000) | SYNE2 | MKRRPLRMKQTWKTPEKSRLILGVNGERARNRHLLSPCVI | LILGVNGERAR | No | Alternative | Alternative | 11 | 2 | ATG | TAG | TransCirc | No |
chr14|64419813|64427473|+|5|circRNA|MTHFD1|ENST00000545908.5|8,9,10,11,12 | circMTHFD1(8,9,10,11,12) | MTHFD1 | LGEGKSTTTIGLVQALGAHLYQNVFACVRQPSQGPTFGIKGK | QPSQGPTFGIKGK | No | Junction | Junction | 13 | 2 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page