top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr14|35775005|35775745|-|2|circRNA|RALGAPA1|ENST00000389698.7|3,2 | circRALGAPA1(3,2) | RALGAPA1 | LDAILFIFERMQNLLILNSFSTNIFHIYTMCSLKIL | LDAILFIFERMQNLLILNSFSTNIFHIYTMCSLK | No | Junction | Junction | 34 | 3 | TTG | TGA | TransCirc | No |
chr14|37247102|37270525|+|5|circRNA|MIPOL1|ENST00000396294.6|4,5,6,7,8 | circMIPOL1(4,5,6,7,8) | MIPOL1 | LAKEDKEQRKLKFKLELQEKETEAKIAEKTAANPKVNEKLRKRLPIPNQHI | IAEKTAANPK | No | Junction | Junction | 10 | 1 | TTG | TAG | TransCirc | No |
chr14|39085761|39096139|-|6|circRNA|SEC23A|NM_006364|7,6,5,4,3,2 | circSEC23A(7,6,5,4,3,2) | SEC23A | LACTTGKETFAFLWGGTFHSCRTAGEIRIKLHNDNLFGIHSTK | LACTTGK | No | Alternative | Junction | 7 | 1 | TTG | TGA | TransCirc | No |
chr14|44945029|44945928|-|1|circRNA|KLHL28|NM_001308112|2 | circKLHL28(2) | KLHL28 | MLKFMLTKWYLPASARISKLCSLETFLKKRTVRLSFNALMKLLSRPLWSMPIQGLFLFLRTQLNLSCQQQTYSR | LSFNALMK | No | Alternative | Alternative | 8 | 1 | ATG | TAA | TransCirc | No |
chr14|44945029|44945928|-|1|circRNA|KLHL28|NM_001308112|2 | circKLHL28(2) | KLHL28 | MLKFMLTKWYLPASARISKLCSLETFLKKRTVRLSFNALMKLLSRPLWSMPIQGLFLFLRTQLNLSCQQQTYSR | TQLNLSCQQQTYSR | No | Alternative | Alternative | 14 | 1 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page