top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr8|1770931|1771597|+|1|circRNA|CLN8|NM_018941|2 | circCLN8(2) | CLN8 | LLGQSPSWPLSSYDHVAPGDEHALYLRFLDALKD | LLGQSPSWPLSSYDHVAPGDEHALYLR | No | Alternative | Junction | 27 | 3 | CTG | TGA | NA | No |
chr8|1770931|1771597|+|1|circRNA|CLN8|NM_018941|2 | circCLN8(2) | CLN8 | MPLTVLWWPERRSSGTWRPRVQSLVFRAQPQACGLCWGTLCCMPTRRVASRTGAGFTSRQQRDSFALKMLQSTCPT | TGAGFTSR | No | Alternative | Alternative | 8 | 2 | ATG | TGA | NA | No |
chr8|17947185|17953186|+|3|circRNA|PCM1|ENST00000325083.12|7,8,9 | circPCM1(7,8,9) | PCM1 | MRVLQEKKQKMDKLLGELHTLRDQHLNNSSCQRSSAGAYGRDRKFEETT | SSAGAYGR | No | Alternative | Junction | 8 | 1 | ATG | TGA | TransCirc | No |
chr8|17956603|18025658|+|28|circRNA|PCM1|ENST00000325083.12|11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38 | circPCM1(11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38) | PCM1 | MVEEEQKNHLSGEICEMQTEELAGNSETLKEPGS | NHLSGEICEMQTEELAGNSETLKEPGS | No | Junction | Junction | 27 | 1 | ATG | TAA | TransCirc | No |
chr8|17980590|17986087|+|3|circRNA|PCM1|ENST00000325083.12|24,25,26 | circPCM1(24,25,26) | PCM1 | MKVPVCLAHVNLAKVGTDIQPRLKSLFKQKYSAERIMSNWKK | VPVCLAHVNLAKVGTDIQPR | No | Alternative | Alternative | 20 | 1 | ATG | TAA | NA | No |
Page 1 of 1
bottom of page