top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr14|102886188|102897401|+|4|circRNA|TRAF3|ENST00000560371.5|6,7,8,9 | circTRAF3(6,7,8,9) | TRAF3 | LKLKLRDKRKCFEIMNPKSFIYRNTKTPTVPAWWCPALTSAASRLS | KCFEIMNPK | No | Alternative | Junction | 9 | 2 | TTG | TGA | TransCirc | No |
chr14|102886188|102897401|+|4|circRNA|TRAF3|ENST00000560371.5|6,7,8,9 | circTRAF3(6,7,8,9) | TRAF3 | LKLKLRDKRKCFEIMNPKSFIYRNTKTPTVPAWWCPALTSAASRLS | NTKTPTVPAWWCPALTSAASR | No | Alternative | Junction | 21 | 2 | TTG | TGA | TransCirc | No |
chr14|102886188|102897401|+|4|circRNA|TRAF3|ENST00000560371.5|6,7,8,9 | circTRAF3(6,7,8,9) | TRAF3 | LKLKLRDKRKCFEIMNPKSFIYRNTKTPTVPAWWCPALTSAASRLS | TPTVPAWWCPALTSAASRLS | No | Alternative | Junction | 20 | 2 | TTG | TGA | TransCirc | No |
chr14|102974015|102981021|-|5|circRNA|CDC42BPB|NM_006035|12,11,10,9,8 | circCDC42BPB(12,11,10,9,8) | CDC42BPB | LRTQWRFAKSVRTPRSGCGGWRSSTAWSGRRRRSCTRSDSSSHPMSRMYLKKRRTSSRD | TPRSGCGGWR | No | Alternative | Junction | 10 | 1 | TTG | TGA | TransCirc | No |
chr14|103467078|103475210|+|3|circRNA|MARK3|NM_001128918|11,12,13 | circMARK3(11,12,13) | MARK3 | LDQLFLLLWRIRKGVRPALQIVTSKKMEFPPGNQVAVLLEERELLQPVPCLGMQVILIRRIFLNARKAPLSLVYYGGNGIFTRRNSRIS | ELLQPVPCLGMQVILIR | No | Alternative | Junction | 17 | 1 | CTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page