top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr14|102325984|102326887|+|1|circRNA|ZNF839|ENST00000558850.5|2 | circZNF839(2) | ZNF839 | LCQGNVWRNKRSGKANAPTDHNPAPNCKKEPAAPGEFLPGGAPYRQPSAAQGTAACENRATVLLPK | QPSAAQGTAACENR | No | Alternative | Alternative | 14 | 3 | TTG | TGA | TransCirc | No |
chr14|102325984|102326887|+|1|circRNA|ZNF839|ENST00000558850.5|2 | circZNF839(2) | ZNF839 | LLGDRVSTRWPAATRSHLCQGNVWRNKRSGKANAPTDHNPAPNCKKEPAAPGEFLPGGAPYRQPSAAQGTAACENRATVLLPK | SHLCQGNVWRNK | No | Alternative | Junction | 12 | 3 | CTG | TGA | TransCirc | No |
chr14|102376649|102376940|+|1|circRNA|TECPR2|NM_001172631|2 | circTECPR2(2) | TECPR2 | LREDSLWKPWPWHRYQSLLHSESSARCTISSMPFRQRSRRVSALSWSISRPSTPTGTTSRWAAASACSICTAGTSTR | CTISSMPFR | No | Alternative | Alternative | 9 | 2 | CTG | TGA | TransCirc | No |
chr14|102376649|102408619|+|3|circRNA|TECPR2|NM_001172631|2,3,4 | circTECPR2(2,3,4) | TECPR2 | LAWSPNGMKLFSGDDKGKIVYSSLDLDQPPGFPR | GKIVYSSLDLDQPPGFPR | No | Junction | Junction | 18 | 1 | CTG | TGA | TransCirc | No |
chr14|102376649|102428382|+|6|circRNA|TECPR2|NM_001172631|2,3,4,5,6,7 | circTECPR2(2,3,4,5,6,7) | TECPR2 | LEGSGDIVSVSCTENEIFFLKGDRNIIRISSRPEGLTSTAPRFP | ISSRPEGLTSTAPRFP | No | Junction | Junction | 16 | 1 | TTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page