top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr13|77206652|77217957|-|4|circRNA|MYCBP2|ENST00000544440.6|24,23,22,21 | circMYCBP2(24,23,22,21) | MYCBP2 | LWCYNAVVADARLPSAADMQSRCSILSPELALPTGSRALTTRSHAALHILGDVPLLFKHCQALAHKSLQAATIRQYF | HCQALAHK | No | Alternative | Junction | 8 | 2 | CTG | TAA | TransCirc | No |
chr13|77918090|77918624|-|1|circRNA|EDNRB|ENST00000377211.8|2 | circEDNRB(2) | EDNRB | LEQVAACSRLQVCADAPWLRWFLPAACRGSGERREASRLTGPLRFCKPQR | EASRLTGPLR | No | Alternative | Alternative | 10 | 2 | CTG | TAA | TransCirc | No |
chr13|77918090|77918624|-|1|circRNA|EDNRB|ENST00000377211.8|2 | circEDNRB(2) | EDNRB | LEQVAACSRLQVCADAPWLRWFLPAACRGSGERREASRLTGPLRFCKPQR | LQVCADAPWLR | No | Alternative | Alternative | 11 | 2 | CTG | TAA | NA | No |
chr13|77918090|77918624|-|1|circRNA|EDNRB|ENST00000377211.8|2 | circEDNRB(2) | EDNRB | LPCVRAGDHRELHTSENYLQEQVHAKRSQYLDRQLGSGRPAAHRH | ELHTSENYLQEQVHAKR | No | Alternative | Alternative | 17 | 3 | CTG | TGA | NA | No |
chr13|93545262|93830545|+|2|circRNA|GPC6|NM_005708|2,3 | circGPC6(2,3) | GPC6 | LWAEKLQTEFPRGTLKNLSSGIYMLHHRNGRQVKPTKQTRI | GTLKNLSSGIYMLHHR | No | Alternative | Junction | 16 | 1 | CTG | TGA | riboCIRC,TransCirc | No |
Page 1 of 1
bottom of page