top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr13|42299362|42308609|+|2|circRNA|AKAP11|ENST00000025301.3|8,9 | circAKAP11(8,9) | AKAP11 | LRPQNQQTGSLMQKSCHLLQVKLADTVTLKNSTIALEIHLSTFSDRVLSPVVSQLLIQNLAAAIRNLGFFISVSLRFMLILIRRQCLLRR | LADTVTLK | No | Alternative | Alternative | 8 | 1 | CTG | TAG | TransCirc | No |
chr13|42299362|42308609|+|2|circRNA|AKAP11|ENST00000025301.3|8,9 | circAKAP11(8,9) | AKAP11 | LYFWNCYFYTGALGRKCPSPISYFIYCMSGQGSSVI | LYFWNCYFYTGALGRK | No | Alternative | Alternative | 16 | 2 | TTG | TGA | TransCirc | No |
chr13|42299362|42308609|+|2|circRNA|AKAP11|ENST00000025301.3|8,9 | circAKAP11(8,9) | AKAP11 | MKVTFVKIKLVKGPWIHIEMRSPNCIVFQPLWFTA | GPWIHIEMRSPNCIVFQPLWFTA | No | Alternative | Alternative | 23 | 1 | ATG | TAA | TransCirc | No |
chr13|42299362|42308609|+|2|circRNA|AKAP11|ENST00000025301.3|8,9 | circAKAP11(8,9) | AKAP11 | MPIGLPTDLLNQDYRKQLRQPKCSATQECSLCQVHK | CSATQECSLCQVHK | No | Alternative | Alternative | 14 | 1 | ATG | TGA | TransCirc | No |
chr13|42299362|42308609|+|2|circRNA|AKAP11|ENST00000025301.3|8,9 | circAKAP11(8,9) | AKAP11 | MPIGLPTDLLNQDYRKQLRQPKCSATQECSLCQVHK | QPKCSATQECSLCQVHK | No | Alternative | Alternative | 17 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page