top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr13|24484652|24493733|-|5|circRNA|PARP4|ENST00000381989.3|12,11,10,9,8 | circPARP4(12,11,10,9,8) | PARP4 | LEVGFISVIRSVAFGGSHEFKHSEPRGERFSRDDLGRGPGPPGTHASQASEQD | LEVGFISVIR | No | Alternative | Junction | 10 | 3 | TTG | TAG | TransCirc | No |
chr13|24484652|24494722|-|6|circRNA|PARP4|ENST00000381989.3|12,11,10,9,8,7 | circPARP4(12,11,10,9,8,7) | PARP4 | LLLPKVVEDRGVQRTDVGNLGSGIYFSDSLRLEDSLL | GVQRTDVGNLGSGIYFSDSLR | No | Alternative | Junction | 21 | 2 | TTG | TAA | TransCirc | No |
chr13|24490667|24498229|-|5|circRNA|PARP4|ENST00000381989.3|10,9,8,7,6 | circPARP4(10,9,8,7,6) | PARP4 | LSMLNRILKNFSGLEKRFCRIITGGNGGRPGSCGGGASVFAGLQGLSFPDILTLPPG | NFSGLEK | No | Alternative | Junction | 7 | 2 | TTG | TGA | TransCirc | No |
chr13|24905345|24910086|-|4|circRNA|CENPJ|NM_018451|7,6,5,4 | circCENPJ(7,6,5,4) | CENPJ | LMMKELGLTLKRICVTMMLFLGMNPLMGRRRHATLIMK | ICVTMMLFLGMNPLMGR | No | Alternative | Alternative | 17 | 2 | TTG | TAG | TransCirc | No |
chr13|24905345|24910086|-|4|circRNA|CENPJ|NM_018451|7,6,5,4 | circCENPJ(7,6,5,4) | CENPJ | LRIERGASAAERIAHKSVMIRGLLRTPGPKKIKGEMLIWICLIKITVAMSLSWKA | GLLRTPGPK | No | Alternative | Alternative | 9 | 2 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page