top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr13|113014762|113045361|+|3|circRNA|MCF2L|ENST00000375608.7|3,4,5 | circMCF2L(3,4,5) | MCF2L | LQDAGIGFILVIDRRRDKWTSVKASVLRIAMKSCTRTSSRSVLPTSRTS | SVLPTSR | No | Alternative | Junction | 7 | 2 | CTG | TAA | TransCirc | No |
chr13|113495501|113510424|+|6|circRNA|TMCO3|NM_017905|2,3,4,5,6,7 | circTMCO3(2,3,4,5,6,7) | TMCO3 | LHLACCGGISCGSNPRRASSFPRVCPCQAHPSCPGSSWAVLGVTKKLKMCV | RASSFPR | No | Alternative | Junction | 7 | 2 | TTG | TGA | TransCirc | No |
chr13|19705661|19782791|-|8|circRNA|PSPC1|NM_001042414|9,8,7,6,5,4,3,2 | circPSPC1(9,8,7,6,5,4,3,2) | PSPC1 | MMGMNMNNRATIPGPPMGPGPAMGPEGAANMGTPMMPDNGAVACIRCPRRTQ | ATIPGPPMGPGPAMGPEGAANMGTPMMPDNGAVACIR | No | Junction | Junction | 37 | 3 | ATG | TAA | NA | No |
chr13|19705661|19782791|-|8|circRNA|PSPC1|NM_001042414|9,8,7,6,5,4,3,2 | circPSPC1(9,8,7,6,5,4,3,2) | PSPC1 | MMGMNMNNRATIPGPPMGPGPAMGPEGAANMGTPMMPDNGAVACIRCPRRTQ | ATIPGPPMGPGPAMGPEGAANMGTPMMPDNGAVACIRCPR | No | Junction | Junction | 40 | 3 | ATG | TAA | NA | No |
chr13|19751270|19759418|-|2|circRNA|PSPC1|NR_003272|4,3 | circPSPC1(4,3) | PSPC1 | MEKQQREQVDRNIREAKEKLEAEMEAARHEHQLMLMRQGPLVQSLWNPWSSLMMKMACQRS | HEHQLMLMRQGPLVQSLWNPWSSLMMK | No | Junction | Junction | 27 | 2 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page