top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr13|111205288|111217880|+|3|circRNA|ARHGEF7|ENST00000317133.9|3,4,5 | circARHGEF7(3,4,5) | ARHGEF7 | LVGGHTQRPDRLVPQQLRARGQGQRRLMQMICIRGRILTRSSVP | LMQMICIRGR | No | Alternative | Junction | 10 | 3 | CTG | TAG | TransCirc | No |
chr13|111205288|111217880|+|3|circRNA|ARHGEF7|ENST00000317133.9|3,4,5 | circARHGEF7(3,4,5) | ARHGEF7 | LVGGHTQRPDRLVPQQLRARGQGQRRLMQMICIRGRILTRSSVP | RLMQMICIR | No | Alternative | Junction | 9 | 3 | CTG | TAG | TransCirc | No |
chr13|111205288|111267670|+|7|circRNA|ARHGEF7|ENST00000317133.9|3,4,5,6,7,8,9 | circARHGEF7(3,4,5,6,7,8,9) | ARHGEF7 | LPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHRRLMQMICIRGRILTRSSVP | TLYLTYCANHPSAVNVLTEHRR | No | Junction | Junction | 22 | 2 | TTG | TAG | TransCirc | No |
chr13|111217678|111283363|+|12|circRNA|ARHGEF7|ENST00000317133.9|5,6,7,8,9,10,11,12,13,14,15,16 | circARHGEF7(5,6,7,8,9,10,11,12,13,14,15,16) | ARHGEF7 | LGTPGASENTQALEPELPAARASPPALSCSLLQGGHDR | ASPPALSCSLLQGGHDR | No | Junction | Junction | 17 | 3 | CTG | TAA | TransCirc | No |
chr13|111233204|111244294|+|3|circRNA|ARHGEF7|ENST00000317133.9|6,7,8 | circARHGEF7(6,7,8) | ARHGEF7 | MGNLEEICSFQQMLVQSLEECTKEACVSQIRNTEEPSQRI | EACVSQIR | No | Alternative | Junction | 8 | 2 | ATG | TGA | riboCIRC,TransCirc | No |
Page 1 of 1
bottom of page