top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr12|94367793|94403262|-|7|circRNA|CEP83|ENST00000397809.9|11,10,9,8,7,6,5 | circCEP83(11,10,9,8,7,6,5) | CEP83 | MMSGGNLKRISMKRNCGLHRWQKRSPGRSFRVLDINSTKIGIAKSPNTTRIRNSNERTF | SPNTTRIR | No | Alternative | Junction | 8 | 3 | ATG | TAG | TransCirc | No |
chr12|95172599|95211267|-|2|circRNA|FGD6|ENST00000343958.8|3,2 | circFGD6(3,2) | FGD6 | LKALTTLIVNMKAIRAMIIFHQCVPAVLSVSISWAIERICV | ALTTLIVNMK | No | Alternative | Alternative | 10 | 2 | CTG | TAA | riboCIRC,TransCirc | No |
chr12|95262905|95282644|+|5|circRNA|VEZT|ENST00000436874.5|4,5,6,7,8 | circVEZT(4,5,6,7,8) | VEZT | LGGTEFRVLQTVSPITFYSQFTSWALTYSSTSASSYLI | LGGTEFR | No | Alternative | Alternative | 7 | 3 | CTG | TGA | NA | No |
chr12|95262905|95282644|+|5|circRNA|VEZT|ENST00000436874.5|4,5,6,7,8 | circVEZT(4,5,6,7,8) | VEZT | MLILPVWKSLSAAMSSIGTLKLSTSQYRSVYPKLNRSQEN | MLILPVWKSLSAAMSSIGTLK | No | Alternative | Alternative | 21 | 2 | ATG | TGA | NA | No |
chr12|96313320|96334865|-|3|circRNA|CDK17|ENST00000261211.7|4,3,2 | circCDK17(4,3,2) | CDK17 | MVRVTKLLGHHLMKSSHLQVFVSEIVYIDGSQWRIFQATFN | LLGHHLMK | No | Alternative | Junction | 8 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page