top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr12|82895817|82930545|+|2|circRNA|TMTC2|ENST00000551915.5|3,4 | circTMTC2(3,4) | TMTC2 | LKSQSKISEAESAYRNALYYRSNMADMLYNLGRTCRFS | SNMADMLYNLGRTCR | No | Junction | Junction | 15 | 3 | CTG | TAA | TransCirc | No |
chr12|861343|862050|+|1|ciRNA|WNK1|ENST00000535572.5|7 | ciWNK1(7) | WNK1 | MILLIGFFSFLLFCTGFLVLNYESYYYTKFEMVVV | MILLIGFFSFLLFCTGFLVLNYESYYYTK | No | Alternative | Alternative | 29 | 2 | ATG | TAG | NA | No |
chr12|861343|862050|+|1|ciRNA|WNK1|ENST00000535572.5|7 | ciWNK1(7) | WNK1 | MILLIGFFSFLLFCTGFLVLNYESYYYTKFEMVVV | MILLIGFFSFLLFCTGFLVLNYESYYYTKFEMVVV | No | Alternative | Alternative | 35 | 2 | ATG | TAG | NA | No |
chr12|871264|883568|+|6|circRNA|WNK1|ENST00000535572.5|9,10,11,12,13,14 | circWNK1(9,10,11,12,13,14) | WNK1 | LWIKCEKLLKKLMKCSVRMSVWNQRVIRDWRVYKERMTMAFQVLRHRGRARVSHPQVA | MTMAFQVLR | No | Alternative | Junction | 9 | 2 | TTG | TAA | TransCirc | No |
chr12|89350587|89351025|-|1|circRNA|DUSP6|ENST00000279488.7|2 | circDUSP6(2) | DUSP6 | LTLPRTSSLTLTETPIVQQTRMVVRCPTASLPSQWRSCPSSTWAVPKTPPTWTCWRNSASSTS | SCPSSTWAVPK | No | Alternative | Alternative | 11 | 1 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page