top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr12|6957653|6958073|+|2|circRNA|PTPN6|ENST00000399448.5|10,11 | circPTPN6(10,11) | PTPN6 | MGSPVSLGVSSASWTRSTSGRKVCLTQGPSSCTAEQMRPILARGGHAACLWALLCDQLRGA | GGHAACLWALLCDQLR | No | Alternative | Junction | 16 | 2 | ATG | TGA | TransCirc | No |
chr12|6967260|6967675|-|1|ciRNA|PHB2|ENST00000543465.5|5 | ciPHB2(5) | PHB2 | LEQGSVVRTGPGIETCPCVYLISFCWRDLSPAPRAPEFPILLHGQADETKANATPCSLALGSLLGVGTTDEI | DLSPAPR | No | Alternative | Junction | 7 | 2 | CTG | TGA | NA | No |
chr12|70552776|70559624|-|4|circRNA|PTPRB|ENST00000334414.10|21,20,19,18 | circPTPRB(21,20,19,18) | PTPRB | LKPEQQHPLPSYLEYRHNASIRVYQTNYFASKCAENPNSNSKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYSSKSSQSYVIC | SSQSYVIC | No | Alternative | Junction | 8 | 3 | CTG | TGA | TransCirc | No |
chr12|70656703|70754301|-|9|circRNA|PTPRR|NM_001207016|10,9,8,7,6,5,4,3,2 | circPTPRR(10,9,8,7,6,5,4,3,2) | PTPRR | LKEEGVVDALSIVCQLRMDRKMFYKGSMKRTKSGAKKDFMLLSFFSASLLL | KDFMLLSFFSASLLL | No | Alternative | Junction | 15 | 2 | CTG | TAG | TransCirc | No |
chr12|70660939|70684783|-|4|circRNA|PTPRR|NM_130846|8,7,6,5 | circPTPRR(8,7,6,5) | PTPRR | MLDVEEDRLASQGRGPVVVHCRSPQQSVFKTKKCNRFIEHLH | GPVVVHCRSPQQSVFK | No | Junction | Junction | 16 | 1 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page