top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr12|31423596|31452476|-|7|circRNA|DENND5B|ENST00000628277.2|12,11,10,9,8,7,6 | circDENND5B(12,11,10,9,8,7,6) | DENND5B | LWTLTTILLSCLKNFHSSPIKWILSKNSLRFLFNLGSLLRAAYIAVRVPAN | AAYIAVR | No | Alternative | Alternative | 7 | 3 | TTG | TGA | NA | No |
chr12|31423596|31452476|-|7|circRNA|DENND5B|ENST00000628277.2|12,11,10,9,8,7,6 | circDENND5B(12,11,10,9,8,7,6) | DENND5B | LWTLTTILLSCLKNFHSSPIKWILSKNSLRFLFNLGSLLRAAYIAVRVPAN | NSLRFLFNLGSLLR | No | Alternative | Alternative | 14 | 3 | TTG | TGA | NA | No |
chr12|31423596|31452476|-|7|circRNA|DENND5B|ENST00000628277.2|12,11,10,9,8,7,6 | circDENND5B(12,11,10,9,8,7,6) | DENND5B | LWTLTTILLSCLKNFHSSPIKWILSKNSLRFLFNLGSLLRAAYIAVRVPAN | WILSKNSLR | No | Alternative | Alternative | 9 | 3 | TTG | TGA | NA | No |
chr12|32327460|32338979|+|4|circRNA|BICD1|ENST00000281474.9|5,6,7,8 | circBICD1(5,6,7,8) | BICD1 | LKGPPSMSEFIQGHRLSKEKRLTVAPPGRAGKGHSFGQPTGVTDTAGTHQGGTDGAA | LTVAPPGR | No | Alternative | Junction | 8 | 2 | CTG | TGA | NA | No |
chr12|32877845|32879032|-|2|circRNA|PKP2|ENST00000340811.8|3,2 | circPKP2(3,2) | PKP2 | LSGRSGRWCPCSPSLRTGLPGPPGIRAPSTAPAR | APSTAPAR | No | Alternative | Alternative | 8 | 2 | CTG | TGA | riboCIRC,TransCirc | No |
Page 1 of 1
bottom of page