top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr12|124362328|124363678|-|1|ciRNA|NCOR2|NM_001077261|22 | ciNCOR2(22) | NCOR2 | LGHGEAGASPTHSAIATAWPGKGGLPVLILGPSGNTLLEGSLSWVRGPLEVPSPGR | GPLEVPSPGR | No | Alternative | Alternative | 10 | 2 | CTG | TGA | NA | No |
chr12|124362328|124363678|-|1|ciRNA|NCOR2|NM_001077261|22 | ciNCOR2(22) | NCOR2 | LGTPSWKVLSAGCVGPWRCLLQGGESGLPSCNWGLRAKRP | CLLQGGESGLPSCNWGLR | No | Alternative | Alternative | 18 | 3 | CTG | TGA | NA | No |
chr12|124362328|124363678|-|1|ciRNA|NCOR2|NM_001077261|22 | ciNCOR2(22) | NCOR2 | LTLTFPFIETENPTGGSMHLQPSSSASVSWRNPRGAEVGTAGEAGRRTGWGSQ | GAEVGTAGEAGRR | No | Alternative | Alternative | 13 | 1 | CTG | TGA | NA | No |
chr12|124362328|124363678|-|1|ciRNA|NCOR2|NM_001077261|22 | ciNCOR2(22) | NCOR2 | LTLTFPFIETENPTGGSMHLQPSSSASVSWRNPRGAEVGTAGEAGRRTGWGSQ | NPRGAEVGTAGEAGR | No | Alternative | Alternative | 15 | 1 | CTG | TGA | NA | No |
chr12|124398118|124486568|-|15|circRNA|NCOR2|NM_001077261|18,17,16,15,14,13,12,11,10,9,8,7,6,5,4 | circNCOR2(18,17,16,15,14,13,12,11,10,9,8,7,6,5,4) | NCOR2 | MELNESSRWTEEEMETAKKGRRAPGVPAPLPRLCLPPVARLHHPAPAAEALPAV | APGVPAPLPR | No | Alternative | Junction | 10 | 3 | ATG | TGA | riboCIRC,TransCirc | No |
Page 1 of 1
bottom of page