top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr12|122994800|123005548|-|9|circRNA|PITPNM2|ENST00000320201.8|14,13,12,11,10,9,8,7,6 | circPITPNM2(14,13,12,11,10,9,8,7,6) | PITPNM2 | LSPAHAIPAAPPCWMAQVPWAGLTLRSPTSSSSGARWGWSWP | SPTSSSSGAR | No | Alternative | Alternative | 10 | 3 | CTG | TGA | NA | No |
chr12|123309309|123315660|-|7|circRNA|SBNO1|ENST00000420886.6|27,26,25,24,23,22,21 | circSBNO1(27,26,25,24,23,22,21) | SBNO1 | MSWEEATKIWAELTGPDDGFYLSLQDVLIDQTKLLLLSMSF | LLLLSMSF | No | Alternative | Junction | 8 | 1 | ATG | TGA | TransCirc | No |
chr12|123321534|123326334|-|4|circRNA|SBNO1|ENST00000420886.6|16,15,14,13 | circSBNO1(16,15,14,13) | SBNO1 | MSSGDDDDFNPFLDESNEDDENVGHRQRAVSASCRSD | AVSASCR | No | Alternative | Junction | 7 | 3 | ATG | TGA | TransCirc | No |
chr12|123334052|123345570|-|4|circRNA|SBNO1|ENST00000420886.6|6,5,4,3 | circSBNO1(6,5,4,3) | SBNO1 | LMFGTKHPFLRKPLIMAGYQHCSLRQLHMQPSSSLHLLQHLC | KPLIMAGYQHCSLRQLHMQPSSSLHLLQHLC | No | Junction | Junction | 31 | 1 | CTG | TGA | NA | No |
chr12|123484179|123499536|-|4|circRNA|RILPL1|ENST00000376874.8|6,5,4,3 | circRILPL1(6,5,4,3) | RILPL1 | MEEENRIPQPPPIAHPRTSPQPESGIKRLHVRAGATGDEEAEGGGGQTTRRDPRQGQGAGPEK | QGQGAGPEK | No | Alternative | Junction | 9 | 2 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page