top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr12|120142823|120144448|-|2|circRNA|GCN1L1|ENST00000300648.6|43,42 | circGCN1L1(43,42) | GCN1L1 | LPLRMITLELPSPTRLLLMRMSLCVTPPCARASGLSPCTLRQPSPCCCPS | MITLELPSPTRLLLMR | No | Junction | Junction | 16 | 3 | CTG | TAG | TransCirc | No |
chr12|12121085|12164562|-|15|circRNA|LRP6|ENST00000538239.5|22,21,20,19,18,17,16,15,14,13,12,11,10,9,8 | circLRP6(22,21,20,19,18,17,16,15,14,13,12,11,10,9,8) | LRP6 | MIQNLCPHLPHPEANTCQQRRTMKAAHLLHTQRGAILITSTHRHPLPVQTPPEEGPSSSDCLQRKNVPTPVLRKTGDVAISASIDLRAFAVLALLALNSSVT | KTGDVAISASIDLR | No | Alternative | Junction | 14 | 3 | ATG | TGA | TransCirc | No |
chr12|12121085|12164562|-|15|circRNA|LRP6|ENST00000538239.5|22,21,20,19,18,17,16,15,14,13,12,11,10,9,8 | circLRP6(22,21,20,19,18,17,16,15,14,13,12,11,10,9,8) | LRP6 | MIQNLCPHLPHPEANTCQQRRTMKAAHLLHTQRGAILITSTHRHPLPVQTPPEEGPSSSDCLQRKNVPTPVLRKTGDVAISASIDLRAFAVLALLALNSSVT | TMKAAHLLHTQR | No | Alternative | Junction | 12 | 3 | ATG | TGA | TransCirc | No |
chr12|121268637|121274585|-|4|circRNA|CAMKK2|NM_001270485|5,4,3,2 | circCAMKK2(5,4,3,2) | CAMKK2 | LWSPSVSRAVLWTSAWRGTGPWRPMAKRSPLTPPGPRPGPTSPVASCLCKSGPRVGWQPVAAWT | GTGPWRPMAK | No | Alternative | Alternative | 10 | 2 | TTG | TGA | TransCirc | No |
chr12|121402741|121417911|+|3|circRNA|RNF34|NM_194271|2,3,4 | circRNF34(2,3,4) | RNF34 | LLLCLRFRESLWMETKHPDLECRHRWGSGTKDQVYC | HRWGSGTK | No | Alternative | Junction | 8 | 2 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page