top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr11|76523154|76526635|+|2|circRNA|C11orf30|ENST00000524490.5|11,12 | circC11orf30(11,12) | C11orf30 | MIVTQPKGIGSTVQPAAKIIPTKIVYGQQGKTQERLPKSLQSQ | TQERLPK | No | Alternative | Junction | 7 | 1 | ATG | TGA | TransCirc | No |
chr11|77907716|77922471|-|6|circRNA|INTS4|ENST00000433818.6|17,16,15,14,13,12 | circINTS4(17,16,15,14,13,12) | INTS4 | LQRLGELQSELAGVADFSATYLRCQLLLIKVLEVSGKSASNPGASLGARASEHPPIF | VLEVSGK | No | Alternative | Junction | 7 | 2 | CTG | TGA | TransCirc | No |
chr11|77955941|77991299|-|6|circRNA|INTS4|ENST00000433818.6|7,6,5,4,3,2 | circINTS4(7,6,5,4,3,2) | INTS4 | LMMRLAKFVTWSVMALGWFVFRQQNCCHRRKLLLRNSD | LAKFVTWSVMALGWFVFR | No | Alternative | Junction | 18 | 3 | TTG | TAA | TransCirc | No |
chr11|78109441|78124214|-|7|circRNA|ALG8|NM_001007027|9,8,7,6,5,4,3 | circALG8(9,8,7,6,5,4,3) | ALG8 | LPYWQLQSGRWITPLSLHGLSISCHMLPNILIKKC | LPYWQLQSGR | No | Junction | Junction | 10 | 1 | TTG | TGA | TransCirc | No |
chr11|78207529|78210744|+|3|circRNA|USP35|ENST00000530267.5|3,4,5 | circUSP35(3,4,5) | USP35 | LRVVCLPAGCREGGGAEPRAVLPHPHTAALLFRPAHHAAPQDPG | EGGGAEPR | No | Alternative | Alternative | 8 | 1 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page