top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr11|68436888|68438682|+|2|circRNA|LRP5|ENST00000294304.11|19,20 | circLRP5(19,20) | LRP5 | LASSSLSSSWVVSILCASAWCASAMRGPTGPSRTSMSAGPRTCPSIS | TSMSAGPR | No | Alternative | Alternative | 8 | 1 | TTG | TAG | TransCirc | No |
chr11|68738699|68747366|-|4|circRNA|MTL5|NM_004923|6,5,4,3 | circMTL5(6,5,4,3) | MTL5 | LAGLKSRKQVVLLQVIIRKKQLCRIFLLRNPVASSHRPRN | LAGLKSR | No | Alternative | Junction | 7 | 1 | TTG | TAG | TransCirc | No |
chr11|68759568|68761687|-|3|circRNA|CPT1A|ENST00000540367.5|17,16,15 | circCPT1A(17,16,15) | CPT1A | LLMTAMVCRTSLWERTSSISTFLPSSLALRRWNRG | LLMTAMVCR | No | Alternative | Junction | 9 | 2 | TTG | TGA | TransCirc | No |
chr11|68759568|68761687|-|3|circRNA|CPT1A|ENST00000540367.5|17,16,15 | circCPT1A(17,16,15) | CPT1A | LLMTAMVCRTSLWERTSSISTFLPSSLALRRWNRG | LLMTAMVCRTSLWER | No | Alternative | Junction | 15 | 2 | TTG | TGA | TransCirc | No |
chr11|68761534|68762761|-|2|circRNA|CPT1A|ENST00000540367.5|15,14 | circCPT1A(15,14) | CPT1A | LGSIVTSSAFTWCLNISLWSPLSLRKTWASFASHTRPP | LGSIVTSSAFTWCLNISLWSPLSLR | Yes | Alternative | Junction | 25 | 2 | CTG | TGA | riboCIRC,TransCirc | No |
Page 1 of 1
bottom of page