top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr8|116655855|116726172|-|4|circRNA|EIF3H|ENST00000521861.5|5,4,3,2 | circEIF3H(5,4,3,2) | EIF3H | LKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASRWY | HELLSLASR | No | Alternative | Junction | 9 | 2 | TTG | TAA | TransCirc | No |
chr8|119783380|119791459|-|6|circRNA|TAF2|NM_003184|16,15,14,13,12,11 | circTAF2(16,15,14,13,12,11) | TAF2 | LSKLILCGSISSAMREMLLHSRNPFWLWKNSLLQHLGLHSLIY | LILCGSISSAMREMLLHSR | No | Alternative | Alternative | 19 | 3 | TTG | TAG | NA | No |
chr8|120575085|120632651|-|2|circRNA|SNTB1|NM_021021|4,3 | circSNTB1(4,3) | SNTB1 | MTACHGGRKPGSAQFTHTLFLPPGSLKSTLQMLSTR | KPGSAQFTHTLFLPPGSLKSTLQMLSTR | No | Junction | Junction | 28 | 2 | ATG | TGA | TransCirc | No |
chr8|123077110|123126687|+|12|circRNA|TBC1D31|ENST00000287380.5|2,3,4,5,6,7,8,9,10,11,12,13 | circTBC1D31(2,3,4,5,6,7,8,9,10,11,12,13) | TBC1D31 | LTREEWLKLFDNIFSNHPSFLLMTVVAYNICSRTPLLSCNLKDDFENYSEHYSQHFRLPSKSFAIFECGF | DDFENYSEHYSQHFR | No | Junction | Junction | 15 | 1 | CTG | TGA | TransCirc | No |
chr8|123084161|123097441|+|3|circRNA|TBC1D31|ENST00000287380.5|4,5,6 | circTBC1D31(4,5,6) | TBC1D31 | LAAGGKSNHLHLWCLEARQLFRIIQMPTKVRAIRHLEFLPDSFDAGSNQSPRS | AIRHLEFLPDSFDAGSNQSPR | No | Junction | Junction | 21 | 2 | CTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page