top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr19|55852015|55862159|+|4|circRNA|NLRP4|ENST00000301295.10|2,3,4,5 | circNLRP4(2,3,4,5) | NLRP4 | LVSLLQKRWQPLSSLILVLCGIWRSSKRRSSGNLKNISSK | RSSGNLK | No | Alternative | Alternative | 7 | 1 | TTG | TGA | NA | No |
chr19|5700788|5705992|-|2|circRNA|LONP1|ENST00000587552.5|8,7 | circLONP1(8,7) | LONP1 | LAHVHPLGQVQQREPGPGAGTGSAGGRPLRHGGRQETHPGGGEDQADPP | EPGPGAGTGSAGGRPLR | No | Alternative | Junction | 17 | 1 | CTG | TAA | TransCirc | No |
chr19|5707059|5712002|-|4|circRNA|LONP1|NM_001276479|8,7,6,5 | circLONP1(8,7,6,5) | LONP1 | LYKALSLLKKEFELSKLQQRLGRESPYQQTAGGGARGAGGGEQAQAPQEVKAGQEGGGGRAERQAPGGAGDGAHP | AGQEGGGGR | No | Alternative | Junction | 9 | 1 | CTG | TGA | TransCirc | No |
chr19|57397174|57398429|+|1|ciRNA|AC003002.6|ENST00000596617.5|3 | ciAC003002.6(3) | AC003002.6 | MELLPPTRVNMHFSSISVLTGKALTLAQCPGLGCVTPFYPKAALRFPQ | MELLPPTRVNMHFSSISVLTGK | No | Junction | Junction | 22 | 1 | ATG | TGA | NA | No |
chr19|57863403|57868457|-|1|ciRNA|ZNF814|ENST00000595894.5|3 | ciZNF814(3) | ZNF814 | LDREQDGPDIIRGRPLLLQDVQAYVTLGVHVRVVAGCEELHCGCIVKVGSH | LDREQDGPDIIR | No | Alternative | Alternative | 12 | 2 | CTG | TGA | NA | No |
Page 1 of 1
bottom of page