top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr19|42343476|42348472|+|5|circRNA|MEGF8|ENST00000378073.5|9,10,11,12,13 | circMEGF8(9,10,11,12,13) | MEGF8 | LVYRGFIYPMLPGGPGGPGAEDVAVWTRAQRLHVLARMARGPDTENMAEQRLPVVGTHM | GPDTENMAEQRLPVVGTHM | No | Junction | Junction | 19 | 1 | CTG | TAG | TransCirc | No |
chr19|42343476|42348472|+|5|circRNA|MEGF8|ENST00000378073.5|9,10,11,12,13 | circMEGF8(9,10,11,12,13) | MEGF8 | LVYRGFIYPMLPGGPGGPGAEDVAVWTRAQRLHVLARMARGPDTENMAEQRLPVVGTHM | MARGPDTENMAEQR | No | Junction | Junction | 14 | 1 | CTG | TAG | TransCirc | No |
chr19|42343476|42348472|+|5|circRNA|MEGF8|ENST00000378073.5|9,10,11,12,13 | circMEGF8(9,10,11,12,13) | MEGF8 | MCPWSTVASSTQCCLEGQVDQGLRTWPCGRGPSAYTSWPGWPVALTRRTWPSSASQWSVLTCSCGAWWQRPVGGWGVQRPAPWGLDGVQGAPLCVPGTCP | GPSAYTSWPGWPVALTRR | No | Alternative | Junction | 18 | 2 | ATG | TGA | TransCirc | No |
chr19|42405384|42410842|-|7|circRNA|LIPE|ENST00000244289.8|8,7,6,5,4,3,2 | circLIPE(8,7,6,5,4,3,2) | LIPE | LGKRPSGCQAFLPVYGSRRWGWSRPWAACWVWRTSLTWTQRHRPTGTAA | LGKRPSGCQAFLPVYGSR | No | Alternative | Alternative | 18 | 1 | CTG | TAG | TransCirc | No |
chr19|43652224|43656640|-|3|circRNA|PLAUR|ENST00000339082.7|6,5,4 | circPLAUR(6,5,4) | PLAUR | LPRPHESMSGSHRHSRPGCHLFPKPLPRMHFLWLIRHEL | LPRPHESMSGSHR | No | Alternative | Junction | 13 | 2 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page