top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr19|39979816|39980717|+|4|circRNA|PSMC4|ENST00000157812.6|7,8,9,10 | circPSMC4(7,8,9,10) | PSMC4 | LHSSGSWARSLYRSIWVRAPAWSGMCSAWPRRMHLPSSS | APAWSGMCSAWPR | No | Alternative | Alternative | 13 | 3 | CTG | TAG | TransCirc | No |
chr19|4012922|4013349|+|1|circRNA|PIAS4|NM_015897|2 | circPIAS4(2) | PIAS4 | LTVALSCSRRSRSCTRPATPRRTRSLPHSRTGPWTP | SCTRPATPR | No | Alternative | Alternative | 9 | 2 | TTG | TGA | TransCirc | No |
chr19|40255157|40265351|-|3|circRNA|AKT2|ENST00000392038.6|4,3,2 | circAKT2(4,3,2) | AKT2 | MPADEDREAATQHLCHTLPAVDHSHREDLPRGFSRRETVPCPRCLLHVLLP | RETVPCPR | Yes | Junction | Junction | 8 | 2 | ATG | TGA | riboCIRC,TransCirc | No |
chr19|40458154|40458545|-|2|circRNA|BLVRB|NM_000713|3,2 | circBLVRB(3,2) | BLVRB | LHLGLRSDSAGAGLLQAAIRGAPAGPRGSGRCSAGSRCGQDRGWAGRCHRAAGHPQ | GAPAGPR | No | Alternative | Junction | 7 | 2 | CTG | TGA | TransCirc | No |
chr19|4053970|4055247|-|1|circRNA|ZBTB7A|ENST00000322357.8|2 | circZBTB7A(2) | ZBTB7A | LQRLRLLWAGPPGRAAPDGGRGRGRQQPGSVARAG | AAPDGGRGR | No | Alternative | Alternative | 9 | 2 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page