top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr19|18537600|18538433|-|2|circRNA|FKBP8|NM_001308373|6,5 | circFKBP8(6,5) | FKBP8 | MTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKEPIHPPARGPVPGGDPEDGCGRA | EPIHPPARGPVPGGDPEDGCGR | No | Alternative | Junction | 22 | 3 | ATG | TGA | TransCirc | No |
chr19|18537600|18538433|-|2|circRNA|FKBP8|NM_001308373|6,5 | circFKBP8(6,5) | FKBP8 | MTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKEPIHPPARGPVPGGDPEDGCGRA | GKEPIHPPAR | No | Junction | Junction | 10 | 3 | ATG | TGA | TransCirc | No |
chr19|19001612|19004646|-|2|circRNA|SUGP2|ENST00000452918.6|8,7 | circSUGP2(8,7) | SUGP2 | MTKIVLLSNSIERKCLNYVHQFVSRHLRTTFTLVVVTPRVLRRAPWTSWKGKQSLKTSPLRGRLSWRAQR | HLRTTFTLVVVTPR | No | Alternative | Alternative | 14 | 2 | ATG | TGA | TransCirc | No |
chr19|19009854|19031082|-|4|circRNA|SUGP2|ENST00000452918.6|5,4,3,2 | circSUGP2(5,4,3,2) | SUGP2 | LKHLRPLLPAHLLTGKITWQPDELHRRLLMLYYKKKPNDITWMPVVRL | ITWQPDELHRR | No | Alternative | Junction | 11 | 3 | CTG | TAA | TransCirc | No |
chr19|19009854|19031082|-|4|circRNA|SUGP2|ENST00000452918.6|5,4,3,2 | circSUGP2(5,4,3,2) | SUGP2 | LKHLRPLLPAHLLTGKITWQPDELHRRLLMLYYKKKPNDITWMPVVRL | KPNDITWMPVVR | No | Alternative | Junction | 12 | 3 | CTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page