top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|122471374|122474517|-|2|circRNA|CADPS2|NM_001009571|13,12 | circCADPS2(13,12) | CADPS2 | LMEHSENGAVIDPTLLHYSFAFCASHVHGNRCRSFSETWYG | CRSFSETWYG | No | Alternative | Junction | 10 | 1 | CTG | TGA | TransCirc | No |
chr7|122471374|122581290|-|7|circRNA|CADPS2|NM_001009571|13,12,11,10,9,8,7 | circCADPS2(13,12,11,10,9,8,7) | CADPS2 | LCLSCARQQMGDSRRFHHHPSSACGQSETLHRKHWSSGPGR | HWSSGPGR | No | Alternative | Junction | 8 | 3 | CTG | TAA | TransCirc | No |
chr7|12369544|12370509|-|1|circRNA|VWDE|NM_001135924|12 | circVWDE(12) | VWDE | LSGDSSQLQHRKAVSCFSWQEIRQCYRDVCEGCSVKR | AVSCFSWQEIR | No | Alternative | Alternative | 11 | 1 | CTG | TGA | TransCirc | No |
chr7|128591849|128609579|+|3|circRNA|RP11-274B21.14|TCONS_l2_00026190|4,5,6 | circRP11-274B21.14(4,5,6) | RP11-274B21.14 | MTSSTAPLWFRWQCCKGGNRGAVCSANPHVSDASKTSA | GGNRGAVCSANPHVSDASK | No | Alternative | Junction | 19 | 3 | ATG | TGA | TransCirc | No |
chr7|128626294|128626530|+|1|circRNA|RP11-274B21.14|TCONS_l2_00026208|3 | circRP11-274B21.14(3) | RP11-274B21.14 | LSCGFMAFLPFVVLAKWNLNDILSRWINPSFPVLEYRKWMDK | WINPSFPVLEYR | No | Alternative | Alternative | 12 | 1 | CTG | TAA | NA | No |
Page 1 of 1
bottom of page