top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr19|1274440|1274626|+|1|ciRNA|CIRBP|ENST00000585913.5|7 | ciCIRBP(7) | CIRBP | LLSRTYGPMAGAFRCVLGAGQRLPGAPGPPPGARACSRKCFREEWHVALSPVPGGTWAFQ | TYGPMAGAFRCVLGAGQR | No | Alternative | Junction | 18 | 3 | CTG | TGA | NA | No |
chr19|1274440|1274626|+|1|ciRNA|CIRBP|ENST00000585913.5|7 | ciCIRBP(7) | CIRBP | LSRAAPGRFSESCSPAPMAPWRAPFGVCWVQGSASRERRVPRLEPAPVLVSAFGKSGMWR | APFGVCWVQGSASR | No | Alternative | Junction | 14 | 1 | CTG | TGA | NA | No |
chr19|1274440|1274626|+|1|ciRNA|CIRBP|ENST00000585913.5|7 | ciCIRBP(7) | CIRBP | LSRAAPGRFSESCSPAPMAPWRAPFGVCWVQGSASRERRVPRLEPAPVLVSAFGKSGMWR | APFGVCWVQGSASRER | No | Alternative | Junction | 16 | 1 | CTG | TGA | NA | No |
chr19|1274440|1274626|+|1|ciRNA|CIRBP|ENST00000585913.5|7 | ciCIRBP(7) | CIRBP | LSRAAPGRFSESCSPAPMAPWRAPFGVCWVQGSASRERRVPRLEPAPVLVSAFGKSGMWR | LSRAAPGR | No | Alternative | Junction | 8 | 1 | CTG | TGA | NA | No |
chr19|13135199|13136405|+|2|circRNA|NACC1|NM_052876|2,3 | circNACC1(2,3) | NACC1 | LGAAAMAAARWPSSPRRTWLPTGLTSPRHPNRLRWWQQPSPPWLREQGSQPVGWQQQGVW | LGAAAMAAARWPSSPR | No | Alternative | Alternative | 16 | 1 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page