top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr18|20966916|20970513|-|5|circRNA|ROCK1|ENST00000399799.2|27,26,25,24,23 | circROCK1(27,26,25,24,23) | ROCK1 | MSFRCSWPAKRVILSNCVLNFWTSRILQVLLVFLVLMKLMVTSQRNSCYSVGSSRNKS | LMVTSQR | No | Alternative | Junction | 7 | 2 | ATG | TGA | TransCirc | No |
chr18|21366026|21384403|+|3|circRNA|GREB1L|ENST00000584446.5|2,3,4 | circGREB1L(2,3,4) | GREB1L | MKWKMMKTMKKCLIQTAHQFPIHKNLPQKDLALQMVHKKL | DLALQMVHK | No | Junction | Junction | 9 | 1 | ATG | TAA | riboCIRC,TransCirc | No |
chr18|21815615|21819646|+|2|circRNA|MIB1|ENST00000578646.5|11,12 | circMIB1(11,12) | MIB1 | LEAGADVTITNNNGFNALHHAALRGNPRIKMVIEQFTMQLLEMKALL | IKMVIEQFTMQLLEMK | No | Alternative | Junction | 16 | 1 | TTG | TAG | TransCirc | No |
chr18|22936753|23001729|+|14|circRNA|RBBP8|ENST00000327155.9|2,3,4,5,6,7,8,9,10,11,12,13,14,15 | circRBBP8(2,3,4,5,6,7,8,9,10,11,12,13,14,15) | RBBP8 | MIAWKICLIGQHMKSMNPVWQTVSPKQQMKRRNCLLPQRNYTVFDLSKDDLIPL | ICLIGQHMK | No | Alternative | Junction | 9 | 1 | ATG | TAA | riboCIRC | No |
chr18|22936753|23001729|+|14|circRNA|RBBP8|ENST00000327155.9|2,3,4,5,6,7,8,9,10,11,12,13,14,15 | circRBBP8(2,3,4,5,6,7,8,9,10,11,12,13,14,15) | RBBP8 | MIAWKICLIGQHMKSMNPVWQTVSPKQQMKRRNCLLPQRNYTVFDLSKDDLIPL | ICLIGQHMKSMNPVWQTVSPK | No | Alternative | Junction | 21 | 1 | ATG | TAA | riboCIRC | No |
Page 1 of 1
bottom of page