top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr18|12356693|12367382|-|6|circRNA|AFG3L2|NM_006796|9,8,7,6,5,4 | circAFG3L2(9,8,7,6,5,4) | AFG3L2 | MSPSSPLVDLSFWRCSLVWALLEIKASCYHTLFWRRRWWRWKTRWQER | ASCYHTLFWR | No | Alternative | Junction | 10 | 2 | ATG | TGA | NA | No |
chr18|12356693|12367382|-|6|circRNA|AFG3L2|NM_006796|9,8,7,6,5,4 | circAFG3L2(9,8,7,6,5,4) | AFG3L2 | MSPSSPLVDLSFWRCSLVWALLEIKASCYHTLFWRRRWWRWKTRWQER | ASCYHTLFWRR | No | Alternative | Junction | 11 | 2 | ATG | TGA | NA | No |
chr18|12356693|12367382|-|6|circRNA|AFG3L2|NM_006796|9,8,7,6,5,4 | circAFG3L2(9,8,7,6,5,4) | AFG3L2 | MSPSSPLVDLSFWRCSLVWALLEIKASCYHTLFWRRRWWRWKTRWQER | CSLVWALLEIK | No | Junction | Junction | 11 | 2 | ATG | TGA | NA | No |
chr18|12356693|12367382|-|6|circRNA|AFG3L2|NM_006796|9,8,7,6,5,4 | circAFG3L2(9,8,7,6,5,4) | AFG3L2 | MSPSSPLVDLSFWRCSLVWALLEIKASCYHTLFWRRRWWRWKTRWQER | CSLVWALLEIKASCYHTLFWR | No | Junction | Junction | 21 | 2 | ATG | TGA | NA | No |
chr18|12366964|12371691|-|4|circRNA|AFG3L2|NM_006796|5,4,3,2 | circAFG3L2(5,4,3,2) | AFG3L2 | LLCSGVESCFTCCSRDPGEKSLGRTLSITIFQKEYFTDLLQLKQGPAEILF | TLSITIFQKEYFTDLLQLK | No | Junction | Junction | 19 | 2 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page