top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|7899543|7899890|+|1|ciRNA|CHD3|NM_001005271|15 | ciCHD3(15) | CHD3 | LLGEQSNGSCWEPQSGQGVWFWRCRCMVVRWQLNGQ | CRCMVVR | No | Alternative | Alternative | 7 | 1 | CTG | TAA | NA | No |
chr17|79944907|79947831|-|2|circRNA|TBC1D16|NM_001271844|6,5 | circTBC1D16(6,5) | TBC1D16 | LYLRELLRLTHVRFYQHLVSLGEDGLQMLFCHRWLLLCFKREFPEAEALRIWEACWAHYQEDPAELRRVQPCRRLFPRDVGPGGAHLGRGPG | DVGPGGAHLGR | No | Alternative | Junction | 11 | 1 | CTG | TGA | TransCirc | No |
chr17|80105748|80117109|+|14|circRNA|GAA|NM_000152|3,4,5,6,7,8,9,10,11,12,13,14,15,16 | circGAA(3,4,5,6,7,8,9,10,11,12,13,14,15,16) | GAA | LATSPWAHGTTCRRSKIQLTGATRCPWRPRMSTAGHRPHSTAWSSPRSPSG | LATSPWAHGTTCRR | No | Alternative | Junction | 14 | 3 | CTG | TGA | TransCirc | No |
chr17|80263573|80289837|+|5|circRNA|RNF213|NM_020954|2,3,4,5,6 | circRNF213(2,3,4,5,6) | RNF213 | LRPRPRTRWLLLKKKSVRMNKGSLKTSRSQRGRTEVQLL | GRTEVQLL | No | Alternative | Alternative | 8 | 2 | CTG | TGA | TransCirc | No |
chr17|80263573|80289837|+|5|circRNA|RNF213|NM_020954|2,3,4,5,6 | circRNF213(2,3,4,5,6) | RNF213 | LRPRPRTRWLLLKKKSVRMNKGSLKTSRSQRGRTEVQLL | MNKGSLK | No | Alternative | Alternative | 7 | 2 | CTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page