top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|98915722|98917679|+|2|circRNA|TRRAP|ENST00000355540.7|19,20 | circTRRAP(19,20) | TRRAP | LHSMGLRHWSAKASGRWSCVWTTCSPTSSTTTSSRCAQSSCSLTCTRL | CAQSSCSLTCTR | No | Junction | Junction | 12 | 1 | CTG | TGA | TransCirc | No |
chr7|98933240|98950262|+|10|circRNA|TRRAP|ENST00000355540.7|27,28,29,30,31,32,33,34,35,36 | circTRRAP(27,28,29,30,31,32,33,34,35,36) | TRRAP | LQHDILKRVYGGRDSQKLQHRSETCPVLSLCRLQRPQLRR | LQHDILK | No | Alternative | Alternative | 7 | 1 | CTG | TGA | NA | No |
chr7|98976148|98978904|+|5|circRNA|TRRAP|ENST00000355540.7|52,53,54,55,56 | circTRRAP(52,53,54,55,56) | TRRAP | MLQGIEPVGSPDGVRSVQRPHQPLPRPGVRLAGVQLDCHEGGAGADWSAAQRFRSAVPHFHDAGREDVGPAFPQIVEDPL | LAGVQLDCHEGGAGADWSAAQRFR | No | Junction | Junction | 24 | 1 | ATG | TGA | TransCirc | No |
chr7|99004415|99005130|+|1|ciRNA|TRRAP|ENST00000355540.7|66 | ciTRRAP(66) | TRRAP | LVAEMQGMSSWLLALAGEWASLAGGTNPRRPWTWSPMGAPGWTLWGILDTDSLTWENIR | LAGGTNPR | No | Alternative | Junction | 8 | 1 | CTG | TGA | NA | No |
chr7|99045697|99054865|-|6|circRNA|SMURF1|NM_001199847|11,10,9,8,7,6 | circSMURF1(11,10,9,8,7,6) | SMURF1 | MKMRPKDLKKRLMVKFRGEEGLDYGGVASQFTDTRQNRNRRLGGGLQRTVRK | GEEGLDYGGVASQFTDTR | No | Junction | Junction | 18 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page