top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|61992539|62052705|-|9|circRNA|MED13|ENST00000397786.6|11,10,9,8,7,6,5,4,3 | circMED13(11,10,9,8,7,6,5,4,3) | MED13 | MKKMLCHYLVPLSSKKKKMECGRMDFPMNAVLCFSKQFTIYWNGV | MDFPMNAVLCFSK | No | Alternative | Junction | 13 | 2 | ATG | TAA | TransCirc | No |
chr17|61992539|62052705|-|9|circRNA|MED13|ENST00000397786.6|11,10,9,8,7,6,5,4,3 | circMED13(11,10,9,8,7,6,5,4,3) | MED13 | MKKMLCHYLVPLSSKKKKMECGRMDFPMNAVLCFSKQFTIYWNGV | MDFPMNAVLCFSKQFTIYWNGV | No | Alternative | Junction | 22 | 2 | ATG | TAA | TransCirc | No |
chr17|61992539|62052705|-|9|circRNA|MED13|ENST00000397786.6|11,10,9,8,7,6,5,4,3 | circMED13(11,10,9,8,7,6,5,4,3) | MED13 | MKKMLCHYLVPLSSKKKKMECGRMDFPMNAVLCFSKQFTIYWNGV | MECGRMDFPMNAVLCFSK | No | Alternative | Junction | 18 | 2 | ATG | TAA | TransCirc | No |
chr17|62282701|62292033|-|10|circRNA|RP11-51L5.5|ENST00000582394.1|11,10,9,8,7,6,5,4,3,2 | circRP11-51L5.5(11,10,9,8,7,6,5,4,3,2) | RP11-51L5.5 | LLLFTIYKWNVHPYYQWGPTPTNIHPQWNAKHCCAMWN | LLLFTIYK | No | Alternative | Alternative | 8 | 2 | TTG | TGA | NA | No |
chr17|62282701|62292033|-|10|circRNA|RP11-51L5.5|ENST00000582394.1|11,10,9,8,7,6,5,4,3,2 | circRP11-51L5.5(11,10,9,8,7,6,5,4,3,2) | RP11-51L5.5 | MECSSLLPMGTYPDQYSSPMECQTLLCHVELRRTSQMEWLMVTCHLFLTAPLQVTSLQSTEKWKCTFSECTFKAGISLYRLF | AGISLYR | No | Alternative | Junction | 7 | 1 | ATG | TAG | NA | No |
Page 1 of 1
bottom of page