top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|59682628|59685808|+|8|circRNA|CLTC|ENST00000621829.4|23,24,25,26,27,28,29,30 | circCLTC(23,24,25,26,27,28,29,30) | CLTC | MQCSMLLNLKILNWLKNSCSGFCRKKKESALELVCLPVTIF | NSCSGFCRK | No | Alternative | Alternative | 9 | 2 | ATG | TAA | riboCIRC,TransCirc | No |
chr17|60451879|60460787|-|4|circRNA|APPBP2|ENST00000083182.7|12,11,10,9 | circAPPBP2(12,11,10,9) | APPBP2 | MHIKAIQIKEQLLGQEDYEVALSVGHLASLYNYDMNQYENAEKLYLRSIAIGSP | SIAIGSP | No | Alternative | Junction | 7 | 1 | ATG | TGA | TransCirc | No |
chr17|60494465|60500487|-|2|circRNA|APPBP2|ENST00000083182.7|3,2 | circAPPBP2(3,2) | APPBP2 | LLHHCFQALMDHGVKVASVLAYSFSRRCSYIAESDAAVKEKAIQVGFVLALPTGTLMSTGQ | AIQVGFVLALPTGTLMSTGQ | No | Junction | Junction | 20 | 2 | TTG | TGA | TransCirc | No |
chr17|61715950|61801474|-|10|circRNA|BRIP1|NM_032043|17,16,15,14,13,12,11,10,9,8 | circBRIP1(17,16,15,14,13,12,11,10,9,8) | BRIP1 | LRGLLPGRQWYEIQAYRALNQALGRENPAIFIMEFIKLVISTHYRLSKGCAKPGI | ALNQALGRENPAIFIMEFIK | No | Junction | Junction | 20 | 1 | TTG | TAG | TransCirc | No |
chr17|61715950|61801474|-|10|circRNA|BRIP1|NM_032043|17,16,15,14,13,12,11,10,9,8 | circBRIP1(17,16,15,14,13,12,11,10,9,8) | BRIP1 | LRGLLPGRQWYEIQAYRALNQALGRENPAIFIMEFIKLVISTHYRLSKGCAKPGI | ENPAIFIMEFIK | No | Alternative | Junction | 12 | 1 | TTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page