top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|51273361|51280479|+|5|circRNA|UTP18|ENST00000225298.11|5,6,7,8,9 | circUTP18(5,6,7,8,9) | UTP18 | MEGLQHPHSLQIVRKYTPLRMKVKRMKMICCKGLGISYPHQLLFQEES | GLGISYPHQLLFQEES | No | Alternative | Junction | 16 | 2 | ATG | TGA | TransCirc | No |
chr17|5338018|5346925|+|2|circRNA|RABEP1|NM_001083585|5,6 | circRABEP1(5,6) | RABEP1 | LNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKLRKELHEGPRGC | ELHEGPR | No | Alternative | Junction | 7 | 1 | CTG | TGA | TransCirc | No |
chr17|5405056|5416682|-|5|circRNA|NUP88|NM_002532|6,5,4,3,2 | circNUP88(6,5,4,3,2) | NUP88 | LEILESCWVHCPCILRLKITMVMMRVLYSAYPVSPIS | ITMVMMR | No | Alternative | Alternative | 7 | 3 | CTG | TAG | NA | No |
chr17|54912665|54930206|+|5|circRNA|TOM1L1|ENST00000570371.5|5,6,7,8,9 | circTOM1L1(5,6,7,8,9) | TOM1L1 | MQERIMDLLVVVENEDVTVELIQVNEDLNNAILGYESLLTCVCRTVVQVSSL | IMDLLVVVENEDVTVELIQVNEDLNNAILGYESLLTCVCR | No | Junction | Junction | 40 | 1 | ATG | TGA | TransCirc | No |
chr17|57105440|57111924|+|3|circRNA|AKAP1|ENST00000337714.7|2,3,4 | circAKAP1(2,3,4) | AKAP1 | LARLQVVCVRPVSSKGRRKRAVSQFTRKLSWAQTLRSLPQQRQLLPRRMLASPCQAYQQRAHHHQRPT | RAVSQFTR | No | Alternative | Alternative | 8 | 3 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page