top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|49298105|49312042|-|3|circRNA|ZNF652|ENST00000508237.5|7,6,5 | circZNF652(7,6,5) | ZNF652 | LHFLMTFISFKYSDLWNFIISYQLMSTHKRHAIYMRNLWKIIQTQYVTQGALLAAFWREAL | YSDLWNFIISYQLMSTHK | No | Junction | Junction | 18 | 2 | TTG | TAG | NA | No |
chr17|4938338|4938975|-|3|circRNA|SLC25A11|ENST00000225665.11|5,4,3 | circSLC25A11(5,4,3) | SLC25A11 | MARAVVVNAAQLASYSQSKQFLLDSGCRLACCVRPPTPLPALASIPCCLSA | AVVVNAAQLASYSQSKQFLLDSGCR | No | Junction | Junction | 25 | 1 | ATG | TGA | TransCirc | No |
chr17|4952794|4953845|+|4|circRNA|ENO3|ENST00000520221.5|3,4,5,6 | circENO3(3,4,5,6) | ENO3 | LGPMPSWACPWPCVRREQLRRGSPCTATSQISLGTLTSYSQCQPIPSSCAQWGFHGYL | LGPMPSWACPWPCVRR | No | Alternative | Junction | 16 | 1 | TTG | TGA | TransCirc | No |
chr17|49607249|49619385|-|5|circRNA|SPOP|ENST00000393328.6|9,8,7,6,5 | circSPOP(9,8,7,6,5) | SPOP | MMCFIYTGKAPNLDKMADDLLAAADKVFASKPQRVR | MADDLLAAADKVFASKPQR | No | Junction | Junction | 19 | 1 | ATG | TGA | TransCirc | No |
chr17|49607249|49619385|-|5|circRNA|SPOP|ENST00000393328.6|9,8,7,6,5 | circSPOP(9,8,7,6,5) | SPOP | MMCFIYTGKAPNLDKMADDLLAAADKVFASKPQRVR | VFASKPQR | No | Alternative | Junction | 8 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page