top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|47601607|47612602|+|4|circRNA|NPEPPS|ENST00000530173.5|16,17,18,19 | circNPEPPS(16,17,18,19) | NPEPPS | LRGLVLGKLGKAGHKATLEEARRRFKDHVEGKQILSADLRSPVKIVPSGWSLSQSLLVKTPTRPN | QILSADLRSPVK | No | Junction | Junction | 12 | 3 | CTG | TAA | TransCirc | No |
chr17|47661118|47668410|+|5|circRNA|KPNB1|ENST00000535458.6|5,6,7,8,9 | circKPNB1(5,6,7,8,9) | KPNB1 | MMMTMTGTPAKQQGCASCFWPPAVKMTLSHMSSPSLKNTSRTQIGGTGMQQ | MMMTMTGTPAK | No | Alternative | Alternative | 11 | 2 | ATG | TGA | NA | No |
chr17|47661118|47668410|+|5|circRNA|KPNB1|ENST00000535458.6|5,6,7,8,9 | circKPNB1(5,6,7,8,9) | KPNB1 | MMMTMTGTPAKQQGCASCFWPPAVKMTLSHMSSPSLKNTSRTQIGGTGMQQ | MTLSHMSSPSLKNTSR | No | Alternative | Alternative | 16 | 2 | ATG | TGA | NA | No |
chr17|47664158|47670832|+|5|circRNA|KPNB1|ENST00000535458.6|7,8,9,10,11 | circKPNB1(7,8,9,10,11) | KPNB1 | LAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRSQSKQ | LLETTDRSQSK | No | Junction | Junction | 11 | 1 | CTG | TGA | TransCirc | No |
chr17|47915311|47923274|+|3|circRNA|SP2|ENST00000376741.4|2,3,4 | circSP2(2,3,4) | SP2 | MQPSWRQLPRQCRPSTSMVSRSRACLSPSPTQAIHRPAWLPLLL | QCRPSTSMVSRSR | No | Alternative | Junction | 13 | 2 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page