top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr7|95225960|95284330|+|10|circRNA|PPP1R9A|ENST00000433360.5|8,9,10,11,12,13,14,15,16,17 | circPPP1R9A(8,9,10,11,12,13,14,15,16,17) | PPP1R9A | MDYKSKQEKPKSLLFFNLWKAFSTYVCSLDPRNQYRRICHR | AFSTYVCSLDPRNQYR | No | Junction | Junction | 16 | 1 | ATG | TGA | NA | No |
chr7|95269206|95284330|+|4|circRNA|PPP1R9A|ENST00000433360.5|14,15,16,17 | circPPP1R9A(14,15,16,17) | PPP1R9A | MDYKSKQEKPKSLLFFNLWKAFSTYVCSLDPRNQSIKQFL | AFSTYVCSLDPRNQSIK | No | Junction | Junction | 17 | 1 | ATG | TAA | NA | No |
chr7|96146555|96193183|-|9|circRNA|SLC25A13|ENST00000265631.9|14,13,12,11,10,9,8,7,6 | circSLC25A13(14,13,12,11,10,9,8,7,6) | SLC25A13 | LVLESVLCLSCGTWGFLGSTRKYNWSTQSKPLCNGTMLGLGESQPSTSETSWSPSAPMS | YNWSTQSKPLCNGTMLGLGESQPSTSETSWSPSAPMS | No | Alternative | Junction | 37 | 2 | CTG | TGA | TransCirc | No |
chr7|96170044|96193183|-|8|circRNA|SLC25A13|ENST00000265631.9|13,12,11,10,9,8,7,6 | circSLC25A13(13,12,11,10,9,8,7,6) | SLC25A13 | MVRSHLQQKFLLEAAKYNWSTQSKPLCNGTMLGLGESQPSTSETSWSPSAPMS | SHLQQKFLLEAAK | No | Junction | Junction | 13 | 2 | ATG | TGA | TransCirc | No |
chr7|96184276|96193183|-|6|circRNA|SLC25A13|ENST00000265631.9|11,10,9,8,7,6 | circSLC25A13(11,10,9,8,7,6) | SLC25A13 | MQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGNTTGARKASLCATGQC | GNTTGAR | Yes | Alternative | Junction | 7 | 3 | ATG | TAG | TransCirc | No |
Page 1 of 1
bottom of page