top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|44147857|44149027|+|1|circRNA|C17orf53|ENST00000319977.8|3 | circC17orf53(3) | C17orf53 | LFKHFSLSKLLEGPFRAALKIVSLVSHSSLQVPG | IVSLVSHSSLQVPG | No | Alternative | Alternative | 14 | 2 | CTG | TAA | TransCirc | No |
chr17|44147857|44149027|+|1|circRNA|C17orf53|ENST00000319977.8|3 | circC17orf53(3) | C17orf53 | LLPAGHPSSPPIPPPEPKLAVSLAQLGSCLTRISCLLWRMQRTGLLAHCL | ISCLLWR | No | Alternative | Junction | 7 | 2 | CTG | TGA | TransCirc | No |
chr17|44405920|44438715|-|5|circRNA|GPATCH8|ENST00000335500.8|6,5,4,3,2 | circGPATCH8(6,5,4,3,2) | GPATCH8 | LLEMSLQDPARMRKNRKKPFGGSMSWQSKENKLNAL | KPFGGSMSWQSKENK | No | Alternative | Junction | 15 | 2 | TTG | TGA | TransCirc | No |
chr17|45081643|45086652|+|2|circRNA|NMT1|ENST00000592782.5|3,4 | circNMT1(3,4) | NMT1 | LSCSQWVRDLPKPWRRLASEATSSGIRSPSPSWWFESSQ | LASEATSSGIR | No | Alternative | Junction | 11 | 2 | TTG | TGA | TransCirc | No |
chr17|45117993|45118492|-|2|circRNA|PLCD3|ENST00000619929.4|7,6 | circPLCD3(7,6) | PLCD3 | LPRDAAAWSWTAGRGQEGSPSSIMAIPSPPRFSSGTWSKPCATMPSRQAA | DAAAWSWTAGR | No | Alternative | Junction | 11 | 3 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page