top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|40479673|40480768|-|2|circRNA|TNS4|ENST00000254051.10|10,9 | circTNS4(10,9) | TNS4 | LEPWPCRKPSPPPLRGTSSPRPPWSTSKSQSRASL | GTSSPRPPWSTSKSQSR | No | Alternative | Alternative | 17 | 1 | CTG | TGA | TransCirc | No |
chr17|4066446|4086655|-|14|circRNA|ZZEF1|NM_015113|28,27,26,25,24,23,22,21,20,19,18,17,16,15 | circZZEF1(28,27,26,25,24,23,22,21,20,19,18,17,16,15) | ZZEF1 | MKQKSLMSLGNEAEEKHSSEATEVNPESLARGKNASLPKPCFCSYSRAASLCCREMYWLLLRRKRLQSKALKE | LQSKALK | No | Alternative | Junction | 7 | 1 | ATG | TAG | TransCirc | No |
chr17|4095830|4124051|-|10|circRNA|ZZEF1|NM_015113|11,10,9,8,7,6,5,4,3,2 | circZZEF1(11,10,9,8,7,6,5,4,3,2) | ZZEF1 | LVPSVGWCLPITHLQINFVRKNTSKGLKNMTNGSFRSSGNL | GLKNMTNGSFR | No | Alternative | Alternative | 11 | 2 | TTG | TAA | TransCirc | No |
chr17|4102316|4105809|-|3|circRNA|ZZEF1|NM_015113|9,8,7 | circZZEF1(9,8,7) | ZZEF1 | MSKEKKISLDPKTSLLNRGQGMEGAAAHASTLSLTRIYRFLNFPLP | GQGMEGAAAHASTLSLTR | No | Junction | Junction | 18 | 1 | ATG | TAA | TransCirc | No |
chr17|4102316|4105809|-|3|circRNA|ZZEF1|NM_015113|9,8,7 | circZZEF1(9,8,7) | ZZEF1 | MSKEKKISLDPKTSLLNRGQGMEGAAAHASTLSLTRIYRFLNFPLP | GQGMEGAAAHASTLSLTRIYR | No | Junction | Junction | 21 | 1 | ATG | TAA | TransCirc | No |
Page 1 of 1
bottom of page