top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr17|16034764|16101805|-|26|circRNA|NCOR1|NM_001190440|44,43,42,41,40,39,38,37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22,21,20,19 | circNCOR1(44,43,42,41,40,39,38,37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22,21,20,19) | NCOR1 | LYIQKGITIGRRQGGPGKTGPLQQVQKIVLIQKVLLLLHQLKLSSPARTVLKMLLLEETQNLRLSLSPPRKLHPVHLPP | VLLLLHQLKLSSPAR | No | Alternative | Junction | 15 | 1 | CTG | TAG | riboCIRC,TransCirc | No |
chr17|16086281|16101805|-|4|circRNA|NCOR1|NM_001190440|22,21,20,19 | circNCOR1(22,21,20,19) | NCOR1 | MGGSISQVQKIVLIQKVLLLLHQLKLSSPARTVLKMLLLEETQNLRLSLSPPRKLHPVHLPP | MGGSISQVQK | No | Junction | Junction | 10 | 3 | ATG | TAG | riboCIRC,TransCirc | No |
chr17|16098366|16101757|-|2|circRNA|NCOR1|ENST00000268712.7|21,20 | circNCOR1(21,20) | NCOR1 | MFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMLKLSSPARTVLKMLLLEETQNLRLSLSPPRKLHPVHLPP | AAVIPPMLK | No | Junction | Junction | 9 | 2 | ATG | TAG | TransCirc | No |
chr17|16117887|16139186|-|7|circRNA|NCOR1|ENST00000268712.7|18,17,16,15,14,13,12 | circNCOR1(18,17,16,15,14,13,12) | NCOR1 | MVVTGQQLLKWWERKVKLNVKTSILTIKGDTILTTSYSSINRKIMRNKCGSSL | GDTILTTSYSSINR | No | Alternative | Junction | 14 | 1 | ATG | TGA | TransCirc | No |
chr17|16117887|16139186|-|7|circRNA|NCOR1|ENST00000268712.7|18,17,16,15,14,13,12 | circNCOR1(18,17,16,15,14,13,12) | NCOR1 | MVVTGQQLLKWWERKVKLNVKTSILTIKGDTILTTSYSSINRKIMRNKCGSSL | MVVTGQQLLK | No | Alternative | Junction | 10 | 1 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page