top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr16|89748658|89767237|-|7|circRNA|FANCA|ENST00000389301.7|33,32,31,30,29,28,27 | circFANCA(33,32,31,30,29,28,27) | FANCA | LPSSVLCGSSFQAEQPITARCEQFFHLVNSEMILYSSNFLLSLQVFFPVTRYFVQLLISRPY | CEQFFHLVNSEMILYSSNFLLSLQVFFPVTR | No | Junction | Junction | 31 | 2 | CTG | TAA | TransCirc | No |
chr16|89791402|89796018|-|4|circRNA|FANCA|ENST00000389301.7|14,13,12,11 | circFANCA(14,13,12,11) | FANCA | LGGAFDGPGIRELPAGQHGHCVPGCAPGSTGGPLCVPVICRLVQGSECSVDTRLAV | LGGAFDGPGIR | No | Alternative | Junction | 11 | 2 | CTG | TAA | TransCirc | No |
chr16|89892192|89900794|+|7|circRNA|TCF25|ENST00000263347.11|6,7,8,9,10,11,12 | circTCF25(6,7,8,9,10,11,12) | TCF25 | LSQLPNFAFSVPLAYFLLSQQTDLPECEQSSARQKASLLIQQALTMFPGGHGRDNVCTPSAHG | ASLLIQQALTMFPGGHGRDNVCTPSAHG | No | Junction | Junction | 28 | 1 | CTG | TGA | riboCIRC,TransCirc | No |
chr16|89892192|89900794|+|7|circRNA|TCF25|ENST00000263347.11|6,7,8,9,10,11,12 | circTCF25(6,7,8,9,10,11,12) | TCF25 | LSQLPNFAFSVPLAYFLLSQQTDLPECEQSSARQKASLLIQQALTMFPGGHGRDNVCTPSAHG | QKASLLIQQALTMFPGGHGR | No | Junction | Junction | 20 | 1 | CTG | TGA | riboCIRC,TransCirc | No |
chr16|89895037|89900794|+|5|circRNA|TCF25|ENST00000263347.11|8,9,10,11,12 | circTCF25(8,9,10,11,12) | TCF25 | LSQLPNFAFSVPLAYFLLSQQTDLPECEQSSARQKASLLIQQALTMFPGGSAPDEPLPR | ASLLIQQALTMFPGGSAPDEPLPR | No | Junction | Junction | 24 | 1 | CTG | TGA | riboCIRC,TransCirc | No |
Page 1 of 1
bottom of page