top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr16|88004294|88027650|+|4|circRNA|BANP|ENST00000286122.11|5,6,7,8 | circBANP(5,6,7,8) | BANP | LASQNPTGTESSRASTPSAARRGGASSGARAWRSRASRGERPTRPPTALQRRPPDYSNTQQ | ASRGERPTRPPTALQR | No | Junction | Junction | 16 | 1 | TTG | TGA | riboCIRC,TransCirc | No |
chr16|88004294|88027650|+|4|circRNA|BANP|ENST00000286122.11|5,6,7,8 | circBANP(5,6,7,8) | BANP | LASQNPTGTESSRASTPSAARRGGASSGARAWRSRASRGERPTRPPTALQRRPPDYSNTQQ | ASTPSAAR | No | Alternative | Junction | 8 | 1 | TTG | TGA | riboCIRC,TransCirc | No |
chr16|8801798|8813106|+|6|circRNA|PMM2|ENST00000566983.5|2,3,4,5,6,7 | circPMM2(2,3,4,5,6,7) | PMM2 | LMSFLMDGTRDTVCDMWKMTVIRPFISLETKLCQKLPKKWMTSYKN | DTVCDMWKMTVIRPFISLETK | No | Alternative | Junction | 21 | 1 | TTG | TGA | TransCirc | No |
chr16|8801798|8813106|+|6|circRNA|PMM2|ENST00000566983.5|2,3,4,5,6,7 | circPMM2(2,3,4,5,6,7) | PMM2 | LMSFLMDGTRDTVCDMWKMTVIRPFISLETKLCQKLPKKWMTSYKN | MTVIRPFISLETKLCQK | No | Junction | Junction | 17 | 1 | TTG | TGA | TransCirc | No |
chr16|88622196|88628854|+|8|circRNA|ZC3H18|NM_001294340|10,11,12,13,14,15,16,17 | circZC3H18(10,11,12,13,14,15,16,17) | ZC3H18 | LIKEAGSAMNHQTRTGRALLQPSGPTHPQTEPPS | EAGSAMNHQTRTGR | No | Alternative | Junction | 14 | 2 | CTG | TGA | riboCIRC,TransCirc | No |
Page 1 of 1
bottom of page