top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr16|68687511|68691926|+|2|circRNA|CDH3|NM_001793|12,13 | circCDH3(12,13) | CDH3 | LCATAMAMSKPALDPGREVSSSLCWGLSWLCCEALPPLAREPFC | EVSSSLCWGLSWLCCEALPPLAR | No | Junction | Junction | 23 | 1 | CTG | TAA | TransCirc | No |
chr16|68687511|68691926|+|2|circRNA|CDH3|NM_001793|12,13 | circCDH3(12,13) | CDH3 | LCATAMAMSKPALDPGREVSSSLCWGLSWLCCEALPPLAREPFC | LCATAMAMSKPALDPGR | No | Alternative | Junction | 17 | 1 | CTG | TAA | TransCirc | No |
chr16|68808423|68810341|+|3|circRNA|CDH1|ENST00000261769.9|4,5,6 | circCDH1(4,5,6) | CDH1 | MEILITVTDQNDNKPEFTQEVFKGSVMEGALPGLRFWNPSRIAHISQLLSWPQKTEERLGYSSHQLPRK | GSVMEGALPGLR | No | Junction | Junction | 12 | 1 | ATG | TGA | TransCirc | No |
chr16|68815622|68822038|+|1|new|CDH1|ENST00000261769|6416|0 | circCDH1(NE) | CDH1 | MKPPSLCLLKREWKCPRTLAWARKSHPTLPRSQTHLWNRK | CPRTLAWAR | No | Alternative | Alternative | 9 | 1 | ATG | TAA | TransCirc | No |
chr16|68859883|68863061|+|2|circRNA|TANGO6|ENST00000564180.1|2,3 | circTANGO6(2,3) | TANGO6 | LRDMLDQVYQPLAVRELLILQGGPPQARAQVHYRSQNMMSCWLL | ELLILQGGPPQAR | No | Junction | Junction | 13 | 1 | TTG | TAA | TransCirc | No |
Page 1 of 1
bottom of page