top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr16|58574608|58582903|-|7|circRNA|CNOT1|NM_001265612|16,15,14,13,12,11,10 | circCNOT1(16,15,14,13,12,11,10) | CNOT1 | MTFLKRRCPSILGGLAPEKDQPKSAQLPPETLATMLACLQACAGVFLLRAVGSGVMGKIKVMEHRHTHGM | AVGSGVMGK | No | Alternative | Junction | 9 | 1 | ATG | TAG | TransCirc | No |
chr16|58599235|58599511|-|1|circRNA|CNOT1|NM_001265612|2 | circCNOT1(2) | CNOT1 | LLPPQPAMNLDSLSLALSQISYLVDNLTKKNYRASQQEIQHVPCFRTE | ASQQEIQHVPCFRTE | No | Junction | Junction | 15 | 1 | CTG | TAA | TransCirc | No |
chr16|58675939|58680241|-|6|circRNA|SLC38A7|NM_001308384|7,6,5,4,3,2 | circSLC38A7(7,6,5,4,3,2) | SLC38A7 | LSTWGQVEKSPKLTAPNRWVLLSSLRHVVVRQNPQTLQEEGSRGHGPGQHQQ | SPKLTAPNR | No | Alternative | Junction | 9 | 2 | CTG | TGA | TransCirc | No |
chr16|66622061|66623502|-|2|circRNA|CMTM4|ENST00000330687.8|4,3 | circCMTM4(4,3) | CMTM4 | MTTSEPARSPGMWTVALRSSAWTRFGQHWTQRFPFLYCFNRTGCFKP | MTTSEPAR | No | Alternative | Junction | 8 | 2 | ATG | TAG | TransCirc | No |
chr16|66938036|66939358|+|2|circRNA|CES2|ENST00000417689.5|2,3 | circCES2(2,3) | CES2 | MTFPSDSMSEDCLYLSIYTPAHSHEGSNLPARTQPVPSGPHTRGRCWGVLSM | TQPVPSGPHTRGR | Yes | Alternative | Junction | 13 | 2 | ATG | TGA | TransCirc | No |
Page 1 of 1
bottom of page