top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr16|4700969|4702242|-|3|circRNA|ANKS3|ENST00000614075.4|9,8,7 | circANKS3(9,8,7) | ANKS3 | LTASGLPALQLTGKAFSLSPAPRLRGPPTQDPRAGSSPWLCHLQQQWREPPGRRGPLLPGCHLPHQ | AFSLSPAPRLR | No | Alternative | Junction | 11 | 2 | CTG | TGA | TransCirc | No |
chr16|4700969|4705253|-|4|circRNA|ANKS3|ENST00000614075.4|9,8,7,6 | circANKS3(9,8,7,6) | ANKS3 | MKTKNPDSQWPPRAATDREGFLAESSPQTQRAPYSGPQKSTKI | EGFLAESSPQTQRAPYSGPQK | No | Junction | Junction | 21 | 1 | ATG | TGA | TransCirc | No |
chr16|4705094|4714186|-|2|circRNA|ANKS3|ENST00000614075.4|6,5 | circANKS3(6,5) | ANKS3 | LPCSSETEALPEEGCQHPRGTASPGQDHRHWPGRQSPTASLWESRWTRETTVEPQPGCWPSSTDT | GTASPGQDHR | No | Alternative | Junction | 10 | 2 | CTG | TGA | TransCirc | No |
chr16|4705094|4714186|-|2|circRNA|ANKS3|ENST00000614075.4|6,5 | circANKS3(6,5) | ANKS3 | LPCSSETEALPEEGCQHPRGTASPGQDHRHWPGRQSPTASLWESRWTRETTVEPQPGCWPSSTDT | HWPGRQSPTASLWESR | No | Junction | Junction | 16 | 2 | CTG | TGA | TransCirc | No |
chr16|47237964|47313823|-|5|circRNA|ITFG1|ENST00000320640.10|13,12,11,10,9 | circITFG1(13,12,11,10,9) | ITFG1 | LCSNDCPRKITMEMDTWIIYCQAVKIKIAKRVPST | ITMEMDTWIIYCQAVK | No | Junction | Junction | 16 | 3 | CTG | TAG | TransCirc | No |
Page 1 of 1
bottom of page