top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr16|3757287|3770986|-|6|circRNA|CREBBP|ENST00000262367.9|19,18,17,16,15,14 | circCREBBP(19,18,17,16,15,14) | CREBBP | MSFPHRLCAAMGSSCVPFLAMLPTTAIRIGTGAWCCSS | LCAAMGSSCVPFLAMLPTTAIR | No | Alternative | Junction | 22 | 2 | ATG | TAA | TransCirc | No |
chr16|4261968|4262323|-|1|ciRNA|TFAP4|NM_003223|3 | ciTFAP4(3) | TFAP4 | LLCKAAHSPGIWLVCWTCRRGSLMKIHLCWAALGGCDGTPISVVVPRCQAH | GSLMKIHLCWAALGGCDGTPISVVVPR | Yes | Alternative | Alternative | 27 | 1 | CTG | TGA | NA | No |
chr16|4332214|4333519|+|2|circRNA|GLIS2|ENST00000262366.7|3,4 | circGLIS2(3,4) | GLIS2 | LGWTPPMAAARCPPSARATGTCLQCPVPRFLREDQLGAHCLLPPPTPAPSPCTPWTSRST | ATGTCLQCPVPRFLR | No | Junction | Junction | 15 | 1 | CTG | TGA | TransCirc | No |
chr16|4426092|4426372|+|1|ciRNA|DNAJA3|ENST00000431375.6|1 | ciDNAJA3(1) | DNAJA3 | LLSRQGRERSVEPPAAVMKRPVDREPSPLCQHFWRPLLVRAGSNFRVAVSGPRKE | VAVSGPR | No | Alternative | Junction | 7 | 2 | CTG | TGA | NA | No |
chr16|4463659|4469465|-|3|circRNA|NMRAL1|NM_001305141|5,4,3 | circNMRAL1(5,4,3) | NMRAL1 | LPCSPSTPARSCTMPRCPGWLRGPHTPGRWDIQGSSGDPKP | LPCSPSTPARSCTMPR | No | Alternative | Junction | 16 | 1 | CTG | TAG | riboCIRC | No |
Page 1 of 1
bottom of page