top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr16|23482922|23495778|-|8|circRNA|GGA2|ENST00000309859.8|9,8,7,6,5,4,3,2 | circGGA2(9,8,7,6,5,4,3,2) | GGA2 | MRGVKSCGPRCSGWRVTPLMTMMHSTKPQTQACRNRIGQLSRISVSR | GVKSCGPR | No | Alternative | Junction | 8 | 2 | ATG | TGA | TransCirc | No |
chr16|23482922|23495778|-|8|circRNA|GGA2|ENST00000309859.8|9,8,7,6,5,4,3,2 | circGGA2(9,8,7,6,5,4,3,2) | GGA2 | MRGVKSCGPRCSGWRVTPLMTMMHSTKPQTQACRNRIGQLSRISVSR | IGQLSRISVSR | No | Alternative | Junction | 11 | 2 | ATG | TGA | TransCirc | No |
chr16|23642954|23661281|+|3|circRNA|DCTN5|NM_001199743|2,3,4 | circDCTN5(2,3,4) | DCTN5 | LHSFLYILETMSLLRKIVWSTQHRLVPMFMLGRTV | LHSFLYILETMSLLR | No | Alternative | Alternative | 15 | 3 | TTG | TGA | riboCIRC,TransCirc | No |
chr16|23642954|23661281|+|3|circRNA|DCTN5|NM_001199743|2,3,4 | circDCTN5(2,3,4) | DCTN5 | LHSFLYILETMSLLRKIVWSTQHRLVPMFMLGRTV | LVPMFMLGR | No | Alternative | Alternative | 9 | 3 | TTG | TGA | riboCIRC,TransCirc | No |
chr16|24750725|24791817|+|4|circRNA|TNRC6A|ENST00000315183.11|3,4,5,6 | circTNRC6A(3,4,5,6) | TNRC6A | LGRFVKASQLSRLEQATRHCWILGNPTSYRQTSWYRLAGGTYTSPSKRRRTHRLGGTIPRIYTSQNGD | LGGTIPR | No | Alternative | Alternative | 7 | 2 | TTG | TGA | NA | No |
Page 1 of 1
bottom of page