top of page
Short-Read CircRNA Encoded Peptides
Use criteria below to search among 5,854 circRNA peptides detected by short-read sequencing:
*Click CircRNA to view comprehensive information in new page.
*Short-read circRNA IDs are unique identifiers assigned to each circRNA in the format of "chromosome|start position|end position|strand|number of exons|type of circRNA|gene name|transcript ID|exon indices"
*CircRNA UID (universal identifiers) are named according to nomenclature standards (PMID: 36658223)
CircRNA | CircRNA UID | Gene | ORF | Peptide | ORF Found in Long-Read | Peptide Type | ORF Type | Peptide Length | Frame | Start Codon | Stop Codon | Ribo-Seq Peptide Support | Neoantigen Support |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
chr3|43299753|43303792|+|2|circRNA|SNRK|ENST00000454177.5|3,4 | circSNRK(3,4) | SNRK | MRRSILNSLNIFSSVGPAWQDLSEGMMERLLDYMIWIKPWVEAILPWLNLPGMSLRVKRWQ | LLDYMIWIKPWVEAILPWLNLPGMSLR | No | Alternative | Alternative | 27 | 3 | ATG | TAA | NA | No |
chr3|43340286|43343478|+|2|circRNA|SNRK|ENST00000454177.5|6,7 | circSNRK(6,7) | SNRK | LKIILGFREWTLHQLQSITFPLCHTKISRKRSTTASFSAWCLGT | EWTLHQLQSITFPLCHTKISR | No | Alternative | Alternative | 21 | 3 | TTG | TAG | NA | No |
chr3|43561219|43565727|-|2|circRNA|ANO10|ENST00000292246.7|9,8 | circANO10(9,8) | ANO10 | LMLHYMNKSSWKKKWELICSTSSIALPHSSILPLS | KWELICSTSSIALPHSSILPLS | No | Junction | Junction | 22 | 2 | TTG | TGA | TransCirc | No |
chr3|43561219|43565727|-|2|circRNA|ANO10|ENST00000292246.7|9,8 | circANO10(9,8) | ANO10 | LMLHYMNKSSWKKKWELICSTSSIALPHSSILPLS | LMLHYMNK | No | Alternative | Junction | 8 | 2 | TTG | TGA | TransCirc | No |
chr3|43561219|43565727|-|2|circRNA|ANO10|ENST00000292246.7|9,8 | circANO10(9,8) | ANO10 | LMLHYMNKSSWKKKWELICSTSSIALPHSSILPLS | LMLHYMNKSSWK | No | Alternative | Junction | 12 | 2 | TTG | TGA | TransCirc | No |
Page 1 of 1
bottom of page